PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn284401
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB
Protein Properties Length: 291aa    MW: 33436.4 Da    PI: 9.9961
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn284401genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-171560147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W   Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
       Achn284401 15 RGHWRLSEDEKLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 60
                     899*****************************.***********996 PP

2Myb_DNA-binding569.4e-1867110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++T+eE+++l  a++++G++ W++I+r ++ gRt++ +k++w+ 
       Achn284401  67 RKPFTEEEEKRLFVAHRLHGNK-WALISRLFP-GRTDNAVKNHWHV 110
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1591061IPR017930Myb domain
SMARTSM007171.7E-141463IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-2914108IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-261667IPR009057Homeodomain-like
PfamPF139218.5E-171878No hitNo description
CDDcd001679.16E-131859No hitNo description
PROSITE profilePS5129423.5562116IPR017930Myb domain
SMARTSM007175.9E-1566114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2068115IPR009057Homeodomain-like
CDDcd001671.52E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MDGDASGDDA GTCPRGHWRL SEDEKLRQLV EQYGPQNWNS IAEKLQGRSG KSCRLRWFNQ  60
LDPRINRKPF TEEEEKRLFV AHRLHGNKWA LISRLFPGRT DNAVKNHWHV IMARKGREKS  120
NSMLCGKRRY YQYESSDSNS NFNGNSNPQD HYGLKNARLF EFQVPNKDFR VFSVSPSCSS  180
PSWSTSTKPI SLTTRKLYPV DLFGRDRDYY WERESSNYKR TVASPFGNSK FGDGNGKHGM  240
VKKELVRFGE NSLKFGKIGA IDIDDQEHGD EHFKRKIVPF IDFLGVGISS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32151157107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278632.21e-100PREDICTED: trichome differentiation protein GL1
TrEMBLE0CQL81e-100E0CQL8_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g15260.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-64myb domain protein 52